Structure of PDB 4g6a Chain C Binding Site BS01

Receptor Information

>4g6a Chain C (length=220) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QLLEQSGPSLVKPSQTLSLTCSVTGDSITSGYWNWIRKFPGNKLEYMGYI
SYSGSTYYNLSLRSRISITRDTSKNQYYLQLNSVTTEDTATYYCALITTT
TYAMDYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF
PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC
NVNHKPSNTKVDKKVEPKSC

Ligand information

>4g6a Chain B (length=12) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

QLINTNGSWHIN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4g6a Structure of Hepatitis C Virus Envelope Glycoprotein E2 Antigenic Site 412 to 423 in Complex with Antibody AP33.
Resolution	2.501 Å
Binding residue (original residue number in PDB)	Y33 Y50 Y58 Y100
Binding residue (residue number reindexed from 1)	Y32 Y49 Y57 Y102

External links

PDB	RCSB:4g6a, PDBe:4g6a, PDBj:4g6a
PDBsum	4g6a
PubMed	22973046

[Back to BioLiP]