Structure of PDB 4g5o Chain C Binding Site BS01

Receptor Information
>4g5o Chain C (length=316) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQS
IIAIIRAMGRLKIDFGEAARADDARQLFVLAGVMTPELAGVIKRLWRDGG
VQACFSRSREYLLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVKTTGIV
ETHFTFKDLYFKMFDVGRSERKKWIHCFEGVTAIIFCVALSDYDLVLADE
EMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKRSPLTICYP
EYTGSNTYEEAAAYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDA
VTDVIIKNNLKECGLY
Ligand information
>4g5o Chain E (length=22) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EDFFSLILRSQAKRMDEQRVLL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4g5o Crystal Structures of the scaffolding protein LGN reveal the general mechanism by which GoLoco binding motifs inhibit the release of GDP from Galphai subunits in G-coupled heterotrimeric proteins
Resolution2.9 Å
Binding residue
(original residue number in PDB)
K257 W258
Binding residue
(residue number reindexed from 1)
K219 W220
Enzymatic activity
Catalytic site (original residue number in PDB) E43 T48 R178 D200
Catalytic site (residue number reindexed from 1) E13 T18 R143 D165
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001664 G protein-coupled receptor binding
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0019001 guanyl nucleotide binding
GO:0019003 GDP binding
GO:0031683 G-protein beta/gamma-subunit complex binding
GO:0046872 metal ion binding
Biological Process
GO:0007165 signal transduction
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007193 adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0007194 negative regulation of adenylate cyclase activity
GO:0007212 G protein-coupled dopamine receptor signaling pathway
GO:0016239 positive regulation of macroautophagy
GO:0046039 GTP metabolic process
GO:0051301 cell division
Cellular Component
GO:0000139 Golgi membrane
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005765 lysosomal membrane
GO:0005789 endoplasmic reticulum membrane
GO:0005794 Golgi apparatus
GO:0005813 centrosome
GO:0005834 heterotrimeric G-protein complex
GO:0005856 cytoskeleton
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030496 midbody
GO:0070062 extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4g5o, PDBe:4g5o, PDBj:4g5o
PDBsum4g5o
PubMed
UniProtP08754|GNAI3_HUMAN Guanine nucleotide-binding protein G(i) subunit alpha-3 (Gene Name=GNAI3)

[Back to BioLiP]