Structure of PDB 4f2j Chain C Binding Site BS01

Receptor Information
>4f2j Chain C (length=52) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RECSYCGKFFRSNYYLNIHLRTHTGEKPYKCEFCEYAAAQKTSLRYHLER
HH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4f2j New insights into DNA recognition by zinc fingers revealed by structural analysis of the oncoprotein ZNF217
Resolution2.64 Å
Binding residue
(original residue number in PDB)		Y484 K511 T512 R515
Binding residue
(residue number reindexed from 1)		Y14 K41 T42 R45
Binding affinityPDBbind-CN: Kd=25nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4f2j, PDBe:4f2j, PDBj:4f2j
PDBsum4f2j
PubMed23436653
UniProtO75362|ZN217_HUMAN Zinc finger protein 217 (Gene Name=ZNF217)

[Back to BioLiP]