Structure of PDB 4ezw Chain C Binding Site BS01

Receptor Information
>4ezw Chain C (length=215) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTI
HVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSA
KDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQ
GDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKM
QELAQVSQKLMEIAQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ezw Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		T403 M404 T409 V425 F426 S427 A429 Q433 A435 V436 T437 Q471
Binding residue
(residue number reindexed from 1)		T15 M16 T21 V37 F38 S39 A41 Q45 A47 V48 T49 Q83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005524 ATP binding
GO:0140662 ATP-dependent protein folding chaperone

View graph for
Molecular Function
External links
PDB RCSB:4ezw, PDBe:4ezw, PDBj:4ezw
PDBsum4ezw
PubMed23562829
UniProtP0A6Y8|DNAK_ECOLI Chaperone protein DnaK (Gene Name=dnaK)

[Back to BioLiP]