Structure of PDB 4eya Chain C Binding Site BS01

Receptor Information
>4eya Chain C (length=138) Species: 224324 (Aquifex aeolicus VF5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRYRKGARDTAFLVLYRWDLRGENPGELFKEVVEEKNIKNKDAYEYAKKL
VDTAVRHIEEIDSIIEKHLKGWSIDRLGYVERNALRLGVAELIFLKSKEP
GRVFIDIVDLVKKYADEKAGKFVNGVLSAIYKAYITSS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4eya Crystal structure of a plectonemic RNA supercoil.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		G6 K36 N37 K39 N40 K113
Binding residue
(residue number reindexed from 1)		G6 K36 N37 K39 N40 K113
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006353 DNA-templated transcription termination
GO:0006355 regulation of DNA-templated transcription
GO:0031564 transcription antitermination
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4eya, PDBe:4eya, PDBj:4eya
PDBsum4eya
PubMed22692544
UniProtO66530|NUSB_AQUAE Transcription antitermination protein NusB (Gene Name=nusB)

[Back to BioLiP]