Structure of PDB 4emz Chain C Binding Site BS01

Receptor Information
>4emz Chain C (length=142) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KSSVIGWPAVRERMRRACAWLEAQEEEEVGFPVTPQVPLRPMTYKAAVDL
SHFLKEKGGLEGLIHSQRRQDILDLWIYHTQGYFPDWQNYTPGPGVRYPL
TFGWCYKLVPVEPDKREVLEWRFDSRLAFHHVARELHPEYFK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4emz Structural basis of evasion of cellular adaptive immunity by HIV-1 Nef.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		Q73 P75 P78 M79
Binding residue
(residue number reindexed from 1)		Q36 P38 P41 M42
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005102 signaling receptor binding
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0017124 SH3 domain binding
GO:0019901 protein kinase binding
GO:0031996 thioesterase binding
GO:0042288 MHC class I protein binding
GO:0042609 CD4 receptor binding
GO:0051117 ATPase binding
Biological Process
GO:0006915 apoptotic process
GO:0019049 virus-mediated perturbation of host defense response
GO:0019058 viral life cycle
GO:0033668 symbiont-mediated suppression of host apoptosis
GO:0039505 symbiont-mediated suppression of host antigen processing and presentation of peptide antigen via MHC class II
GO:0039521 suppression by virus of host autophagy
GO:0045225 negative regulation of CD4 production
GO:0046776 symbiont-mediated suppression of host antigen processing and presentation of peptide antigen via MHC class I
GO:0050848 regulation of calcium-mediated signaling
GO:0070206 protein trimerization
GO:0075528 perturbation by virus of host immune response
Cellular Component
GO:0005576 extracellular region
GO:0016020 membrane
GO:0020002 host cell plasma membrane
GO:0044177 host cell Golgi apparatus
GO:0044178 host cell Golgi membrane
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4emz, PDBe:4emz, PDBj:4emz
PDBsum4emz
PubMed22705789
UniProtQ90VU7

[Back to BioLiP]