Structure of PDB 4eb7 Chain C Binding Site BS01

Receptor Information

>4eb7 Chain C (length=135) Species: 224325 (Archaeoglobus fulgidus DSM 4304) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

YSDKVFDHFQNPRNVGKIEDADGVGTVVCGDLMTIYIKVKDNRIEDIKFQ
TFGCAAAIATSSMATEMAKGKTIEEALKITRDAVAEALGGLPKQKMHCSN
LAADALRRAIVDYFRKNGKIDKIKELGLEKELEKM

Ligand information

InChI=1S/2Fe.2S

NIXDOXVAJZFRNF-UHFFFAOYSA-N

SMILES

Software	SMILES
ACDLabs 10.04	[Fe]1S[Fe]S1
CACTVS 3.341 OpenEye OEToolkits 1.5.0	S1[Fe]S[Fe]1

Formula

Fe2 S2

Name

FE2/S2 (INORGANIC) CLUSTER

PDB chain

4eb7 Chain C Residue 201 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4eb7 (IscS-IscU)2 complex structures provide insights into Fe2S2 biogenesis and transfer.
Resolution	2.75 Å
Binding residue (original residue number in PDB)	G34 D35 C58 H101 C102
Binding residue (residue number reindexed from 1)	G30 D31 C54 H97 C98
Annotation score	4

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005506	iron ion binding
GO:0008198	ferrous iron binding
GO:0046872	metal ion binding
GO:0051536	iron-sulfur cluster binding
GO:0051537	2 iron, 2 sulfur cluster binding

	Biological Process
GO:0006879	intracellular iron ion homeostasis
GO:0016226	iron-sulfur cluster assembly

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4eb7, PDBe:4eb7, PDBj:4eb7
PDBsum	4eb7
PubMed	22511353
UniProt	P0DMG2\|ISCU2_ARCFU Iron-sulfur cluster assembly scaffold protein IscU 2 (Gene Name=iscU2)

[Back to BioLiP]