Structure of PDB 4dx9 Chain C Binding Site BS01

Receptor Information
>4dx9 Chain C (length=127) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CAEFRIKYVGAIEKLEGPLDLINYIDVAQQDGKLFVPPEEEFIMGVSKYG
IKVSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASNEEYS
LWVYQCNSLEQAQAICKVLSTAFDSVL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4dx9 Mechanism for KRIT1 Release of ICAP1-Mediated Suppression of Integrin Activation.
Resolution2.99 Å
Binding residue
(original residue number in PDB)
I138 R140 M141 V142 C143 L177 Q181 C184 F191 L195
Binding residue
(residue number reindexed from 1)
I70 R72 M73 V74 C75 L109 Q113 C116 F123 L127
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4dx9, PDBe:4dx9, PDBj:4dx9
PDBsum4dx9
PubMed23317506
UniProtO14713|ITBP1_HUMAN Integrin beta-1-binding protein 1 (Gene Name=ITGB1BP1)

[Back to BioLiP]