Structure of PDB 4dqm Chain C Binding Site BS01

Receptor Information
>4dqm Chain C (length=234) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSEL
STKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQ
DTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSA
ICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKI
TDLRSISAKGAERVITLKMEIPGSMPPLIQEMLE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4dqm Revealing a natural marine product as a novel agonist for retinoic acid receptors with a unique binding mode and inhibitory effects on cancer cells.
Resolution2.75 Å
Binding residue
(original residue number in PDB)		K244 I258 E412
Binding residue
(residue number reindexed from 1)		K63 I77 E231
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0048384 retinoic acid receptor signaling pathway
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4dqm, PDBe:4dqm, PDBj:4dqm
PDBsum4dqm
PubMed22642567
UniProtP10276|RARA_HUMAN Retinoic acid receptor alpha (Gene Name=RARA)

[Back to BioLiP]