Structure of PDB 4d2m Chain C Binding Site BS01

Receptor Information
>4d2m Chain C (length=136) Species: 126794 (Vaccinia virus Ankara) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ILDYLSTERDHVMMAVRYYMSKQRLDDLYRQLPTKTRSYIDIINIYCDKV
SNDYNRDMNIMYDMASTKSFTVYDFNNEVNTIMLDNKGLGVRLATISFIT
ELGRRCMNPVKTIKMFTLLSHTICDDCFVDYITDIS
Ligand information
>4d2m Chain D (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RPEIWIAQELRRIGDEFNAYY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4d2m Structural Insight Into Bh3-Domain Binding of Vaccinia Virus Anti-Apoptotic F1L.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		V100 Y104 M111 M114 D124 F125 N136 G140 V141 L143 A144
Binding residue
(residue number reindexed from 1)		V50 Y54 M61 M64 D74 F75 N86 G90 V91 L93 A94
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0033668 symbiont-mediated suppression of host apoptosis
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:4d2m, PDBe:4d2m, PDBj:4d2m
PDBsum4d2m
PubMed24850748
UniProtO57173|PG045_VACCA Apoptosis regulator OPG045 (Gene Name=OPG045)

[Back to BioLiP]