Structure of PDB 4cz5 Chain C Binding Site BS01

Receptor Information
>4cz5 Chain C (length=32) Species: 7955 (Danio rerio) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSEEIFTLQVRGRERYEILKKLNDSLELSDVV
Ligand information
>4cz5 Chain B (length=28) Species: 7955 (Danio rerio) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EIFTLQVRGRERYEILKKLNDSLELSDV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4cz5 Tracing the Evolution of the P53 Tetramerization Domain
Resolution1.02 Å
Binding residue
(original residue number in PDB)		S324 L325 S328 V330
Binding residue
(residue number reindexed from 1)		S25 L26 S29 V31
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0051262 protein tetramerization

View graph for
Biological Process
External links
PDB RCSB:4cz5, PDBe:4cz5, PDBj:4cz5
PDBsum4cz5
PubMed25185827
UniProtP79734|P53_DANRE Cellular tumor antigen p53 (Gene Name=tp53)

[Back to BioLiP]