Structure of PDB 4cyd Chain C Binding Site BS01

Receptor Information
>4cyd Chain C (length=225) Species: 1718 (Corynebacterium glutamicum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GVQEILSRAGIFQGVDPTAVNNLIQDMETVRFPRGATIFDEGEPGDRLYI
ITSGKVKLARHAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSAVCVTEV
HAATMNSDMLRNWVADHPAIAEQLLRVLARRLRRTNASLADLIFTDVPGR
VAKTLLQLANRFGTQEAGALRVNHDLTQEEIAQLVGASRETVNKALATFA
HRGWIRLEGKSVLIVDTEHLARRAR
Ligand information
>4cyd Chain H (length=20) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AHHHHDYDIPTTENLYFQGH
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4cyd The Crystal Structures of Apo and Camp-Bound Glxr from Corynebacterium Glutamicum Reveal Structural and Dynamic Changes Upon Camp Binding in Crp/Fnr Family Transcription Factors.
Resolution1.82 Å
Binding residue
(original residue number in PDB)
R10 M75 D79 V129 R132 R133 R136 A161 N162 R163 G165 Q167
Binding residue
(residue number reindexed from 1)
R8 M73 D77 V127 R130 R131 R134 A159 N160 R161 G163 Q165
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4cyd, PDBe:4cyd, PDBj:4cyd
PDBsum4cyd
PubMed25469635
UniProtH7C677

[Back to BioLiP]