Structure of PDB 4csa Chain C Binding Site BS01

Receptor Information
>4csa Chain C (length=164) Species: 162145 (human metapneumovirus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRKAPCKYEVRGKCNRGSECKFNHNYWSWPDRYLLIRSNYLLNQLLRDTD
RAAGREDRTQDFVLGSTNVVQGYIDDNQSITKAAACYSLHNIIKQLQEVE
VRQARDNKLSDSKHVALHNLVLSYMEMSKTPASLINNLKRLPREKLKKLA
KLIIDLSAGAENDS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4csa Drastic Changes in Conformational Dynamics of the Antiterminator M2-1 Regulate Transcription Efficiency in Pneumovirinae.
Resolution2.28 Å
Binding residue
(original residue number in PDB)		K4 A5 K8 Y9 C15 N16 F23
Binding residue
(residue number reindexed from 1)		K3 A4 K7 Y8 C14 N15 F22
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0003746 translation elongation factor activity
GO:0005198 structural molecule activity
GO:0046872 metal ion binding
Biological Process
GO:0006414 translational elongation
GO:0046782 regulation of viral transcription
Cellular Component
GO:0005737 cytoplasm
GO:0030430 host cell cytoplasm
GO:0042025 host cell nucleus
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4csa, PDBe:4csa, PDBj:4csa
PDBsum4csa
PubMed24842877
UniProtQ8QN58

[Back to BioLiP]