Structure of PDB 4cn2 Chain C Binding Site BS01

Receptor Information

>4cn2 Chain C (length=82) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCL
IDKRQRNRCQYCRYQKCLAMGMKREAVQEERQ

Ligand information

>4cn2 Chain A (length=17) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tgagttcaagggtcaat

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4cn2 Structural Basis of Natural Promoter Recognition by the Retinoid X Nuclear Receptor.
Resolution	2.069 Å
Binding residue (original residue number in PDB)	K145 H146 Y147 K156 R164 Q206 E208 R209
Binding residue (residue number reindexed from 1)	K17 H18 Y19 K28 R36 Q78 E80 R81
Binding affinity	PDBbind-CN: Kd=38nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0008270	zinc ion binding
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4cn2, PDBe:4cn2, PDBj:4cn2
PDBsum	4cn2
PubMed	25645674
UniProt	P19793\|RXRA_HUMAN Retinoic acid receptor RXR-alpha (Gene Name=RXRA)

[Back to BioLiP]