Structure of PDB 4cfq Chain C Binding Site BS01

Receptor Information
>4cfq Chain C (length=85) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGTDEA
AFQKLMSNLDSNRDNEVDFQEYCVFLSSIAMMSNE
Ligand information
>4cfq Chain R (length=29) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DATETADAMNREVSSLKNKLRRGDLPFVV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4cfq The C-Terminal Random Coil Region Tunes the Ca2+-Binding Affinity of S100A4 Through Conformational Activation.
Resolution1.37 Å
Binding residue
(original residue number in PDB)		N61 L62 S64 Q73 V77 F78 S81
Binding residue
(residue number reindexed from 1)		N58 L59 S61 Q70 V74 F75 S78
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0046914 transition metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:4cfq, PDBe:4cfq, PDBj:4cfq
PDBsum4cfq
PubMed24830809
UniProtP26447|S10A4_HUMAN Protein S100-A4 (Gene Name=S100A4)

[Back to BioLiP]