Structure of PDB 4cc2 Chain C Binding Site BS01

Receptor Information
>4cc2 Chain C (length=61) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GNQVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWWLAEVNGKK
GYVPSNYIRKT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4cc2 Structural Details of Human Tuba Recruitment by Inlc of Listeria Monocytogenes Elucidate Bacterial Cell-Cell Spreading.
Resolution1.55 Å
Binding residue
(original residue number in PDB)		R1527 D1547 T1549 W1554 Y1565 P1567 Y1570 T1574
Binding residue
(residue number reindexed from 1)		R14 D34 T36 W41 Y52 P54 Y57 T61
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4cc2, PDBe:4cc2, PDBj:4cc2
PDBsum4cc2
PubMed24332715
UniProtQ6XZF7|DNMBP_HUMAN Dynamin-binding protein (Gene Name=DNMBP)

[Back to BioLiP]