Structure of PDB 4au2 Chain C Binding Site BS01

Receptor Information

>4au2 Chain C (length=338) Species: 9615 (Canis lupus familiaris) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MLSPKAATLAERSAGLAFSLYQAMAKDQAVENILLSPVVVASSLGLVSLG
GKATTASQAKAVLSLRDEEVHAGLGELLRSLSNSTARNVTWKLGSRLYSV
SFAEDFVRSSKQHYNCEHSALQSINEWAAQTTDGKLPEVTKDDGALLVNA
MFFKPHWDEKFHHKMVDNRGFMVTRSYTVGVTMMHRTGLYNYYDDEKEKL
QIVEMPLAHKLSSLIILMPHHVEPLERLEKLLTKEQLKIWMGKMQKKAVA
ISLPKGVVEVTHDLQKHLAGLGLTEAIDKDLSRMLASVFHATAFEWDTEG
NPELRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVRPK

Ligand information

>4au2 Chain H (length=14) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PPGPPGPRGPPGPP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4au2 Molecular Basis for the Action of the Collagen-Specific Chaperone Hsp47/Serpinh1 and its Structure-Specific Client Recognition.
Resolution	2.3 Å
Binding residue (original residue number in PDB)	M218 R222 M225 H238 L381 D385
Binding residue (residue number reindexed from 1)	M165 R169 M172 H185 L309 D313

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004867	serine-type endopeptidase inhibitor activity
GO:0005518	collagen binding

	Cellular Component
GO:0005581	collagen trimer
GO:0005615	extracellular space
GO:0005783	endoplasmic reticulum

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:4au2, PDBe:4au2, PDBj:4au2
PDBsum	4au2
PubMed	22847422
UniProt	C7C419

[Back to BioLiP]