Structure of PDB 4a76 Chain C Binding Site BS01

Receptor Information
>4a76 Chain C (length=85) Species: 8364 (Xenopus tropicalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVLRGSGHCKWFNVRMGFGFISMTSREGSPLENPVDVFVHQSKLYMEGFR
SLKEGEPVEFTFKKSSKGFESLRVTGPGGNPCLGN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4a76 The Lin28 Cold-Shock Domain Remodels Pre-Let-7 Microrna.
Resolution1.92 Å
Binding residue
(original residue number in PDB)		W39 N41 V42 M44 G45 F46 F48 D64 F66 H68 Q69 F77 R78 K95
Binding residue
(residue number reindexed from 1)		W11 N13 V14 M16 G17 F18 F20 D36 F38 H40 Q41 F49 R50 K67
Binding affinityPDBbind-CN: Kd=59nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:4a76, PDBe:4a76, PDBj:4a76
PDBsum4a76
PubMed22570413
UniProtB4F6I0

[Back to BioLiP]