Structure of PDB 4a2x Chain C Binding Site BS01

Receptor Information
>4a2x Chain C (length=120) Species: 8839 (Anas platyrhynchos) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QKNLLCGKCKAYACSTDDIRIIKDSHHIVLGEAFKERYTTKPHKKPMQFD
GFEKKSKMYCRNNNCQHDWGITVKYLTFDNLPVIKIKSFVMESQMDFQKW
KSINSSLKNFDVEEMSNLYP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4a2x Structural basis for the activation of innate immune pattern-recognition receptor RIG-I by viral RNA.
Resolution4.0 Å
Binding residue
(original residue number in PDB)
K829 Q854 D856
Binding residue
(residue number reindexed from 1)
K23 Q48 D50
Enzymatic activity
Enzyme Commision number 3.6.4.13: RNA helicase.
External links