Structure of PDB 4a1w Chain C Binding Site BS01

Receptor Information
>4a1w Chain C (length=138) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRYRRAFSDL
TSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKE
MQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYG
Ligand information
>4a1w Chain R (length=17) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
WIAQELRRLGDEFNAYY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4a1w Evaluation of Diverse Alpha/Beta-Backbone Patterns for Functional Alpha-Helix Mimicry: Analogues of the Bim Bh3 Domain.
Resolution2.497 Å
Binding residue
(original residue number in PDB)		A93 E96 F97 R100 Y101 F105 L108 T109 L112 Q125 V126 E129 L130 D133 N136 G138 R139 F146 L194 Y195
Binding residue
(residue number reindexed from 1)		A35 E38 F39 R42 Y43 F47 L50 T51 L54 Q67 V68 E71 L72 D75 N78 G80 R81 F88 L136 Y137
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:4a1w, PDBe:4a1w, PDBj:4a1w
PDBsum4a1w
PubMed22040025
UniProtQ07817|B2CL1_HUMAN Bcl-2-like protein 1 (Gene Name=BCL2L1)

[Back to BioLiP]