Structure of PDB 4a1g Chain C Binding Site BS01

Receptor Information
>4a1g Chain C (length=149) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEH
LMKEFLDKKKYHNDPRFISYCLKFAEYNSDLHQFFEFLYNHGIGTLSSPL
YIAWAGHLEAQGELQHASAVLQRGIQNQAEPREFLQQQYRLFQTRLTET
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4a1g Structural Analysis Reveals Features of the Spindle Checkpoint Kinase Bub1-Kinetochore Subunit Knl1 Interaction.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		E50 L57 F75 Y78 N79 S80 D81 Q84 F88
Binding residue
(residue number reindexed from 1)		E49 L56 F74 Y77 N78 S79 D80 Q83 F87
Enzymatic activity
Enzyme Commision number 2.7.11.1: non-specific serine/threonine protein kinase.
Gene Ontology
Biological Process
GO:0007094 mitotic spindle assembly checkpoint signaling

View graph for
Biological Process
External links
PDB RCSB:4a1g, PDBe:4a1g, PDBj:4a1g
PDBsum4a1g
PubMed22331848
UniProtO43683|BUB1_HUMAN Mitotic checkpoint serine/threonine-protein kinase BUB1 (Gene Name=BUB1)

[Back to BioLiP]