Structure of PDB 3wtu Chain C Binding Site BS01

Receptor Information

>3wtu Chain C (length=118) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDP
DEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDL
QSLLGYTPEELHAMLDVK

Ligand information

>3wtu Chain D (length=15) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gaagccacatcctct

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3wtu A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	Q336 L337 W375 K379 K381 M384 K388 R391 Y396
Binding residue (residue number reindexed from 1)	Q18 L19 W57 K61 K63 M66 K70 R73 Y78

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0006357	regulation of transcription by RNA polymerase II

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3wtu, PDBe:3wtu, PDBj:3wtu
PDBsum	3wtu
PubMed	25083921
UniProt	P14921\|ETS1_HUMAN Protein C-ets-1 (Gene Name=ETS1)

[Back to BioLiP]