Structure of PDB 3wbm Chain C Binding Site BS01

Receptor Information
>3wbm Chain C (length=86) Species: 2286 (Saccharolobus shibatae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TPTPSNVVLIGKKPVMNYVLAALTLLNQGVSEIVIKARGRAISKAVDTVE
IVRNRFLPDKIEIKEIRVGSQVVSRVSTIEIAIRKK
Ligand information
>3wbm Chain Y (length=25) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguaagagcacccgacugcucuucc
.........................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3wbm Biochemical and structural insights into RNA binding by Ssh10b, a member of the highly conserved Sac10b protein family in Archaea.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		G15 K16 G43 R44
Binding residue
(residue number reindexed from 1)		G11 K12 G39 R40
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0003723 RNA binding
GO:0004518 nuclease activity
Biological Process
GO:0030261 chromosome condensation
Cellular Component
GO:0005694 chromosome
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3wbm, PDBe:3wbm, PDBj:3wbm
PDBsum3wbm
PubMed24307170
UniProtP60848|ALBA1_SACSH DNA/RNA-binding protein Alba 1 (Gene Name=albA1)

[Back to BioLiP]