Structure of PDB 3waa Chain C Binding Site BS01

Receptor Information
>3waa Chain C (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTA
EVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHI
HKSLIGK
Ligand information
>3waa Chain I (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctgaattcagctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3waa Structural polymorphism in the L1 loop regions of human H2A.Z.1 and H2A.Z.2
Resolution3.2 Å
Binding residue
(original residue number in PDB)		S18 R19 R34 K77
Binding residue
(residue number reindexed from 1)		S5 R6 R21 K64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
GO:0060090 molecular adaptor activity
Biological Process
GO:0006325 chromatin organization
GO:0008150 biological_process
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3waa, PDBe:3waa, PDBj:3waa
PDBsum3waa
PubMed24311584
UniProtQ71UI9|H2AV_HUMAN Histone H2A.V (Gene Name=H2AZ2)

[Back to BioLiP]