Structure of PDB 3wa9 Chain C Binding Site BS01

Receptor Information
>3wa9 Chain C (length=106) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAE
VLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIH
KSLIGK
Ligand information
>3wa9 Chain I (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctgaattcagctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3wa9 Structural polymorphism in the L1 loop regions of human H2A.Z.1 and H2A.Z.2
Resolution3.07 Å
Binding residue
(original residue number in PDB)		S18 R19 R34 R45
Binding residue
(residue number reindexed from 1)		S4 R5 R20 R31
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031490 chromatin DNA binding
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0031507 heterochromatin formation
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0071392 cellular response to estradiol stimulus
Cellular Component
GO:0000786 nucleosome
GO:0000791 euchromatin
GO:0000792 heterochromatin
GO:0001740 Barr body
GO:0005634 nucleus
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3wa9, PDBe:3wa9, PDBj:3wa9
PDBsum3wa9
PubMed24311584
UniProtP0C0S5|H2AZ_HUMAN Histone H2A.Z (Gene Name=H2AZ1)

[Back to BioLiP]