Structure of PDB 3w19 Chain C Binding Site BS01

Receptor Information
>3w19 Chain C (length=38) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3w19 Optimization of novel anti-HIV fusion inhibitor
Resolution1.278 Å
Binding residue
(original residue number in PDB)
L556 Q563 Q567 I573 K574 Q577 D589 Q590
Binding residue
(residue number reindexed from 1)
L4 Q11 Q15 I21 K22 Q25 D37 Q38
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3w19, PDBe:3w19, PDBj:3w19
PDBsum3w19
PubMed
UniProtP03375|ENV_HV1B1 Envelope glycoprotein gp160 (Gene Name=env)

[Back to BioLiP]