Structure of PDB 3vtp Chain C Binding Site BS01

Receptor Information
>3vtp Chain C (length=41) Species: 11686 (Human immunodeficiency virus type 1 (BRU ISOLATE)) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ
Ligand information
>3vtp Chain D (length=27) Species: 11686 (Human immunodeficiency virus type 1 (BRU ISOLATE)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MTWMEWDREINNYTSLIHSLIEESQNQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3vtp The M-T hook structure is critical for design of HIV-1 fusion inhibitors.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		L556 Q563 Q567 I573 K574 Q577 Q590
Binding residue
(residue number reindexed from 1)		L7 Q14 Q18 I24 K25 Q28 Q41
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3vtp, PDBe:3vtp, PDBj:3vtp
PDBsum3vtp
PubMed22879603
UniProtP03377|ENV_HV1BR Envelope glycoprotein gp160 (Gene Name=env)

[Back to BioLiP]