Structure of PDB 3vqm Chain C Binding Site BS01

Receptor Information
>3vqm Chain C (length=103) Species: 273063 (Sulfurisphaera tokodaii str. 7) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EELSRGFYELVYPPVDMYEEGGYLVVVADLAGFNKEKIKARVSGQNELII
EAEREITEPGVKYLTQRPKYVRKVIRLPYNVAKDAEISGKYENGVLTIRI
PIA
Ligand information
>3vqm Chain Q (length=5) Species: 273063 (Sulfurisphaera tokodaii str. 7) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VIKIE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3vqm Structural studies on the oligomeric transition of a small heat shock protein, StHsp14.0
Resolution2.55 Å
Binding residue
(original residue number in PDB)		K47 I50 A52 I99 G101 K102
Binding residue
(residue number reindexed from 1)		K35 I38 A40 I87 G89 K90
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0051082 unfolded protein binding
Biological Process
GO:0006457 protein folding
GO:0009408 response to heat
GO:0009651 response to salt stress
GO:0042542 response to hydrogen peroxide
GO:0051259 protein complex oligomerization

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3vqm, PDBe:3vqm, PDBj:3vqm
PDBsum3vqm
PubMed22613762
UniProtQ970D9

[Back to BioLiP]