Structure of PDB 3vek Chain C Binding Site BS01

Receptor Information
>3vek Chain C (length=96) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRPLTQCTNCQTT
TTTLWRRNASGDPVCNACGLYFKLHQVNRPLTMRKDGIQTRNRKAS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3vek GATA1 directly mediates interactions with closely spaced pseudopalindromic but not distantly spaced double GATA sites on DNA.
Resolution2.63 Å
Binding residue
(original residue number in PDB)		R202 L214 R216 R217 Y223 N280 L284 L288 H289 R293 M297 Q303 T304 R305 R307
Binding residue
(residue number reindexed from 1)		R2 L14 R16 R17 Y23 N66 L70 L74 H75 R79 M83 Q89 T90 R91 R93
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3vek, PDBe:3vek, PDBj:3vek
PDBsum3vek
PubMed26234528
UniProtP17679|GATA1_MOUSE Erythroid transcription factor (Gene Name=Gata1)

[Back to BioLiP]