Structure of PDB 3vd6 Chain C Binding Site BS01

Receptor Information

>3vd6 Chain C (length=96) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRPLTQCTNCQTT
TTTLWRRNASGDPVCNACGLYFKLHQVNRPLTMRKDGIQTRNRKAS

Ligand information

>3vd6 Chain A (length=20) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ttgtcttatcagatggactc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3vd6 GATA1 directly mediates interactions with closely spaced pseudopalindromic but not distantly spaced double GATA sites on DNA.
Resolution	1.98 Å
Binding residue (original residue number in PDB)	R202 L214 R216 R217 Y223 N280 L284 H289 R293 M297 Q303 T304 R305 R307
Binding residue (residue number reindexed from 1)	R2 L14 R16 R17 Y23 N66 L70 H75 R79 M83 Q89 T90 R91 R93

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0008270	zinc ion binding
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0006357	regulation of transcription by RNA polymerase II

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3vd6, PDBe:3vd6, PDBj:3vd6
PDBsum	3vd6
PubMed	26234528
UniProt	P17679\|GATA1_MOUSE Erythroid transcription factor (Gene Name=Gata1)

[Back to BioLiP]