Structure of PDB 3vd1 Chain C Binding Site BS01

Receptor Information

>3vd1 Chain C (length=201) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

HEFIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPI
QIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPA
SHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSS
CVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYRE
Q

Ligand information

>3vd1 Chain G (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgggcatgcccg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3vd1 Structure of p73 DNA-binding domain tetramer modulates p73 transactivation.
Resolution	2.95 Å
Binding residue (original residue number in PDB)	S261 R293 A296 R300
Binding residue (residue number reindexed from 1)	S150 R182 A185 R189

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0006915	apoptotic process

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3vd1, PDBe:3vd1, PDBj:3vd1
PDBsum	3vd1
PubMed	22474346
UniProt	O15350\|P73_HUMAN Tumor protein p73 (Gene Name=TP73)

[Back to BioLiP]