Structure of PDB 3uw9 Chain C Binding Site BS01

Receptor Information
>3uw9 Chain C (length=112) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPM
DMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEK
LFLQKINELPTE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3uw9 Histone recognition and large-scale structural analysis of the human bromodomain family.
Resolution2.3 Å
Binding residue
(original residue number in PDB)
N140 D145
Binding residue
(residue number reindexed from 1)
N85 D90
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3uw9, PDBe:3uw9, PDBj:3uw9
PDBsum3uw9
PubMed22464331
UniProtO60885|BRD4_HUMAN Bromodomain-containing protein 4 (Gene Name=BRD4)

[Back to BioLiP]