Structure of PDB 3uk3 Chain C Binding Site BS01

Receptor Information
>3uk3 Chain C (length=52) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RECSYCGKFFRSNYYLNIHLRTHTGEKPYKCEFCEYAAAQKTSLRYHLER
HH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3uk3 Rediscovering DNA recognition by classical Zinc Fingers.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		F480 R481 Y485 H489 T492 Y506 Q510 T512 S513 Y516
Binding residue
(residue number reindexed from 1)		F10 R11 Y15 H19 T22 Y36 Q40 T42 S43 Y46
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3uk3, PDBe:3uk3, PDBj:3uk3
PDBsum3uk3
PubMed
UniProtO75362|ZN217_HUMAN Zinc finger protein 217 (Gene Name=ZNF217)

[Back to BioLiP]