Structure of PDB 3stz Chain C Binding Site BS01

Receptor Information

>3stz Chain C (length=102) Species: 1916 (Streptomyces lividans)

ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVET
ATTVGYGDLCPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERR
GH

Ligand information

• Ligand ID: MTN
• InChI: InChI=1S/C10H19NO3S2/c1-9(2)6-8(7-15-16(5,13)14)10(3,4)11(9)12/h6,12H,7H2,1-5H3
• InChIKey: MXZPGYFBZHBAQM-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.370: CC1(C)C=C(CS[S](C)(=O)=O)C(C)(C)N1[O]
  OpenEye OEToolkits 1.7.2: CC1(C=C(C(N1[O])(C)C)CSS(=O)(=O)C)C
  ACDLabs 12.01: ON1C(C=C(CSS(=O)(=O)C)C1(C)C)(C)C
• Formula: C10 H18 N O3 S2
• Name: S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl] methanesulfonothioate;
  MTSL
• DrugBank: DB08217
• ZINC: ZINC000002569540
• PDB chain: 3stz Chain C Residue 201

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3stz Mechanism of Cd(2+) Coordination during Slow Inactivation in Potassium Channels.
• Resolution: 2.5 Å
• Binding residue (original residue number in PDB): Q58 G79 L81 C82
• Binding residue (residue number reindexed from 1): Q36 G57 L59 C60
• Annotation score: 1

Gene Ontology

Molecular Function

• GO:0005249 voltage-gated potassium channel activity

Biological Process

• GO:0006813 potassium ion transport

Cellular Component

• GO:0008076 voltage-gated potassium channel complex

External links

• PDB: RCSB:3stz, PDBe:3stz, PDBj:3stz
• PDBsum: 3stz
• PubMed: 22771214
• UniProt: P0A334|KCSA_STRLI pH-gated potassium channel KcsA (Gene Name=kcsA)