Structure of PDB 3sfj Chain C Binding Site BS01

Receptor Information
>3sfj Chain C (length=104) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVT
RVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLL
VTRQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3sfj A CAL Inhibitor with Single-PDZ Specificity Rescues deltaF508-CFTR
Resolution1.24 Å
Binding residue
(original residue number in PDB)		I29 L30 F32 S33 I34 G35 Q40 D41 Q44 N45 T59 H91 L98 T99
Binding residue
(residue number reindexed from 1)		I20 L21 F23 S24 I25 G26 Q31 D32 Q35 N36 T50 H82 L89 T90
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3sfj, PDBe:3sfj, PDBj:3sfj
PDBsum3sfj
PubMed
UniProtO14907|TX1B3_HUMAN Tax1-binding protein 3 (Gene Name=TAX1BP3)

[Back to BioLiP]