Structure of PDB 3rnu Chain C Binding Site BS01

Receptor Information

>3rnu Chain C (length=199) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SAQSDLKEVMVLNATESFVYEPKEQKKMFHATVATENEVFRVKVFNIDLK
EKFTPKKIIAIANYVCRNGFLEVYPFTLVADVNADRNMEIPKGLIRSASV
TPKINQLCSQTKGSFVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGR
LTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNAAAS

Ligand information

>3rnu Chain K (length=16) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gccatcaaagagagag

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3rnu Structures of the HIN Domain:DNA Complexes Reveal Ligand Binding and Activation Mechanisms of the AIM2 Inflammasome and IFI16 Receptor.
Resolution	2.502 Å
Binding residue (original residue number in PDB)	R667 K674
Binding residue (residue number reindexed from 1)	R96 K103

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0002218	activation of innate immune response
GO:0035458	cellular response to interferon-beta

View graph for
Biological Process

External links

PDB	RCSB:3rnu, PDBe:3rnu, PDBj:3rnu
PDBsum	3rnu
PubMed	22483801
UniProt	Q16666\|IF16_HUMAN Gamma-interferon-inducible protein 16 (Gene Name=IFI16)

[Back to BioLiP]