Structure of PDB 3rmp Chain C Binding Site BS01

Receptor Information
>3rmp Chain C (length=75) Species: 632 (Yersinia pestis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLTDAKIRTLKDKPFKVSDSHGLYLLVKPGGSRHWYLKYRISGKESRIAL
GAYPAISLSDARQQREGIRKMLALN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3rmp Structural basis for the recognition of attP substrates by P4-like integrases
Resolution2.21 Å
Binding residue
(original residue number in PDB)		S35 H37 Y39 E48 S49 R50 A52
Binding residue
(residue number reindexed from 1)		S32 H34 Y36 E45 S46 R47 A49
Enzymatic activity
Enzyme Commision number ?
External links