Structure of PDB 3rl7 Chain C Binding Site BS01

Receptor Information
>3rl7 Chain C (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YEYEEITLERGNSGLGFSIAGGTDNPDSSIFITKIITGGAAAQDGRLRVN
DCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVKRR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3rl7 Molecular basis for the recognition of adenomatous polyposis coli by the Discs Large 1 protein.
Resolution2.3 Å
Binding residue
(original residue number in PDB)
S237 I238 N244 H289 L296
Binding residue
(residue number reindexed from 1)
S18 I19 N25 H66 L73
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3rl7, PDBe:3rl7, PDBj:3rl7
PDBsum3rl7
PubMed21858148
UniProtQ12959|DLG1_HUMAN Disks large homolog 1 (Gene Name=DLG1)

[Back to BioLiP]