Structure of PDB 3rjm Chain C Binding Site BS01

Receptor Information
>3rjm Chain C (length=160) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGD
VDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVA
LLSHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGD
ETDRGVDQQD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3rjm Exploiting differences in caspase-2 and -3 S(2) subsites for selectivity: Structure-based design, solid-phase synthesis and in vitro activity of novel substrate-based caspase-2 inhibitors.
Resolution2.55 Å
Binding residue
(original residue number in PDB)		R54 H112 Q153 C155 D158 T160
Binding residue
(residue number reindexed from 1)		R46 H104 Q145 C147 D150 T152
Enzymatic activity
Catalytic site (original residue number in PDB) E52 F53 H112 G113 C155 R156
Catalytic site (residue number reindexed from 1) E44 F45 H104 G105 C147 R148
Enzyme Commision number 3.4.22.55: caspase-2.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3rjm, PDBe:3rjm, PDBj:3rjm
PDBsum3rjm
PubMed21903398
UniProtP42575|CASP2_HUMAN Caspase-2 (Gene Name=CASP2)

[Back to BioLiP]