Structure of PDB 3rer Chain C Binding Site BS01

Receptor Information
>3rer Chain C (length=64) Species: 511693 (Escherichia coli BL21) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVS
QMVYKHAISTVVPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3rer Cooperation of Escherichia coli Hfq hexamers in DsrA binding.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		Q5 Q8 Q41 F42 K56 H57
Binding residue
(residue number reindexed from 1)		Q4 Q7 Q40 F41 K55 H56
Binding affinityPDBbind-CN: Kd=16.7nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3rer, PDBe:3rer, PDBj:3rer
PDBsum3rer
PubMed21979921
UniProtP0A6X3|HFQ_ECOLI RNA-binding protein Hfq (Gene Name=hfq)

[Back to BioLiP]