Structure of PDB 3rdv Chain C Binding Site BS01

Receptor Information
>3rdv Chain C (length=71) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DFRVGERVWVNGNKPGFIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGV
RYFQCEPLKGIFTRPSKLTRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3rdv SLAIN2 links microtubule plus end-tracking proteins and controls microtubule growth in interphase
Resolution1.75 Å
Binding residue
(original residue number in PDB)
F82 W87 I96 K98 N99 I117 F118 T119
Binding residue
(residue number reindexed from 1)
F26 W31 I40 K42 N43 I61 F62 T63
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3rdv, PDBe:3rdv, PDBj:3rdv
PDBsum3rdv
PubMed21646404
UniProtP30622|CLIP1_HUMAN CAP-Gly domain-containing linker protein 1 (Gene Name=CLIP1)

[Back to BioLiP]