Structure of PDB 3rbq Chain C Binding Site BS01

Receptor Information
>3rbq Chain C (length=165) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPP
NAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLK
SFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVD
DRLVMHNKADYSYSG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3rbq UNC119 is required for G protein trafficking in sensory neurons.
Resolution2.0 Å
Binding residue
(original residue number in PDB)
F91 F128 V129 Y131 E163 F196 P197 S218 Y220 N230
Binding residue
(residue number reindexed from 1)
F32 F55 V56 Y58 E90 F123 P124 S145 Y147 N157
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3rbq, PDBe:3rbq, PDBj:3rbq
PDBsum3rbq
PubMed21642972
UniProtQ13432|U119A_HUMAN Protein unc-119 homolog A (Gene Name=UNC119)

[Back to BioLiP]