Structure of PDB 3r85 Chain C Binding Site BS01

Receptor Information
>3r85 Chain C (length=139) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRYRRAFSDL
TSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKE
MQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3r85 Structural changes in the BH3 domain of SOUL protein upon interaction with the anti-apoptotic protein Bcl-xL.
Resolution1.95 Å
Binding residue
(original residue number in PDB)
F97 Y101 A104 D107 L108 Q111 Q125 V126 E129 L130 N136 G138 R139 Y195
Binding residue
(residue number reindexed from 1)
F39 Y43 A46 D49 L50 Q53 Q67 V68 E71 L72 N78 G80 R81 Y137
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:3r85, PDBe:3r85, PDBj:3r85
PDBsum3r85
PubMed21639858
UniProtQ07817|B2CL1_HUMAN Bcl-2-like protein 1 (Gene Name=BCL2L1)

[Back to BioLiP]