Structure of PDB 3qvy Chain C Binding Site BS01

Receptor Information

>3qvy Chain C (length=106) Species: 562 (Escherichia coli)

ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLED
KSPDSPEMHDFRHGFWILIGQIHDALHLANECKVKEAQAAAEQLKTTCNA
CHQKYR

Ligand information

• Ligand ID: ME7
• InChI: InChI=1S/C10H8N2O4/c13-7-1-2-8(14)11(7)5-6-12-9(15)3-4-10(12)16/h1-4H,5-6H2
• InChIKey: PUKLCKVOVCZYKF-UHFFFAOYSA-N
• SMILES:
  ACDLabs 12.01: O=C1N(C(=O)C=C1)CCN2C(=O)C=CC2=O
  CACTVS 3.370: O=C1C=CC(=O)N1CCN2C(=O)C=CC2=O
  OpenEye OEToolkits 1.7.0: C1=CC(=O)N(C1=O)CCN2C(=O)C=CC2=O
• Formula: C10 H8 N2 O4
• Name: 1,1'-ethane-1,2-diylbis(1H-pyrrole-2,5-dione)
• ZINC: ZINC000004203455
• PDB chain: 3qvy Chain C Residue 501

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3qvy Templated construction of a zn-selective protein dimerization motif.
• Resolution: 2.3 Å
• Binding residue (original residue number in PDB): E81 C82
• Binding residue (residue number reindexed from 1): E81 C82
• Annotation score: 1

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 15 21:25:32 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '3qvy', asym_id = 'C', bs = 'BS01', title = 'Templated construction of a zn-selective protein dimerization motif.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='3qvy', asym_id='C', bs='BS01', title='Templated construction of a zn-selective protein dimerization motif.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0005506,0009055,0020037,0022900,0042597', uniprot = '', pdbid = '3qvy', asym_id = 'C'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0005506,0009055,0020037,0022900,0042597', uniprot='', pdbid='3qvy', asym_id='C')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>