Structure of PDB 3qiw Chain C Binding Site BS01

Receptor Information
>3qiw Chain C (length=178) Species: 7130 (Manduca sexta) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVEQSPSALSLHEGTGSALRCNFTTTMRAVQWFRKNSRGSLINLFYLASG
TKENGRLKSAFDSKERYSTLHIRDAQLEDSGTYFCAAEPSSGQKLVFGQG
TILKVYLHIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQDSDVYIT
DKCVLDMRSMDFKSNSAVAWSACANAFN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3qiw Structural basis of specificity and cross-reactivity in T cell receptors specific for cytochrome c-I-E(k).
Resolution3.3 Å
Binding residue
(original residue number in PDB)		R29 S91 S92 Q94
Binding residue
(residue number reindexed from 1)		R28 S90 S91 Q93
External links