Structure of PDB 3qhe Chain C Binding Site BS01

Receptor Information
>3qhe Chain C (length=318) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
REIRVLHLLEQIRAYCETCWEWQEAHEPPMPAPVEHQICPAVCVLMKLSF
DEEHRHAMNELGGLQAIAELLQVDCEMYGLTNDHYSITLRRYAGMALTNL
TFGDVANKATLCSMKGCMRALVAQLKSESEDLQQVIASVLRNLSWRADVN
SKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCTENKADICA
VDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRE
NNCLQTLLQHLKSHSLTIVSNACGTLWNLSADQEALWMGAVSMLKNLIHS
KHKMIAMGSAAALRNLMA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3qhe Crystal structures of the armadillo repeat domain of adenomatous polyposis coli and its complex with the tyrosine-rich domain of sam68
Resolution2.4 Å
Binding residue
(original residue number in PDB)		R463 M503 T506 N507 F510 G511 K516 Q542 R549 N550 S552 W553 R554 S590 W593 N594 A597 H598 K603 N641 M717
Binding residue
(residue number reindexed from 1)		R55 M95 T98 N99 F102 G103 K108 Q134 R141 N142 S144 W145 R146 S182 W185 N186 A189 H190 K195 N233 M304
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008013 beta-catenin binding
Biological Process
GO:0030178 negative regulation of Wnt signaling pathway

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3qhe, PDBe:3qhe, PDBj:3qhe
PDBsum3qhe
PubMed22000517
UniProtP25054|APC_HUMAN Adenomatous polyposis coli protein (Gene Name=APC)

[Back to BioLiP]