Structure of PDB 3q06 Chain C Binding Site BS01

Receptor Information
>3q06 Chain C (length=231) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFVQLAKTVPVQL
YVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERSSDSDGLAPPQHLI
RVEGNLRAEYLDDPNTFRHSVVVPYEPPEVGSDYTTIYFKFMCNSSCMGG
MNRRPILVIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRKKKTM
DGEYFTLQIRGRERFEQFRERNEALELKDAQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3q06 An induced fit mechanism regulates p53 DNA binding kinetics to confer sequence specificity.
Resolution3.2 Å
Binding residue
(original residue number in PDB)
A276 R280
Binding residue
(residue number reindexed from 1)
A181 R185
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006915 apoptotic process
GO:0051262 protein tetramerization
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3q06, PDBe:3q06, PDBj:3q06
PDBsum3q06
PubMed21522129
UniProtP04637|P53_HUMAN Cellular tumor antigen p53 (Gene Name=TP53)

[Back to BioLiP]