Structure of PDB 3pxe Chain C Binding Site BS01

Receptor Information

>3pxe Chain C (length=211) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NKRMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFV
CERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNH
QGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELS
SFTLGTHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTRKWVLDSVALYQCQ
ELDTYLIPQIP

Ligand information

>3pxe Chain G (length=6) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

TSPTFN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3pxe Impact of BRCA1 BRCT Domain Missense Substitutions on Phosphopeptide Recognition.
Resolution	2.85 Å
Binding residue (original residue number in PDB)	S1655 R1699 T1700 K1702 V1741 N1774 M1775
Binding residue (residue number reindexed from 1)	S9 R53 T54 K56 V95 N128 M129

Enzymatic activity

Enzyme Commision number

2.3.2.27: RING-type E3 ubiquitin transferase.

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004842	ubiquitin-protein transferase activity
GO:0008270	zinc ion binding

	Biological Process
GO:0006281	DNA repair
GO:0006974	DNA damage response

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3pxe, PDBe:3pxe, PDBj:3pxe
PDBsum	3pxe
PubMed	21473589
UniProt	P38398\|BRCA1_HUMAN Breast cancer type 1 susceptibility protein (Gene Name=BRCA1)

[Back to BioLiP]