Structure of PDB 3pqz Chain C Binding Site BS01

Receptor Information
>3pqz Chain C (length=97) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LWFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVKH
YLILPSEEERLYFSMDDGQTRFTDLLQLVEFHQLNRGILPCLLRHCC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3pqz Structural basis of binding by cyclic nonphosphorylated Peptide antagonists of grb7 implicated in breast cancer progression
Resolution2.413 Å
Binding residue
(original residue number in PDB)
Y480 L481 M495 I518
Binding residue
(residue number reindexed from 1)
Y51 L52 M65 I88
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3pqz, PDBe:3pqz, PDBj:3pqz
PDBsum3pqz
PubMed21802427
UniProtQ14451|GRB7_HUMAN Growth factor receptor-bound protein 7 (Gene Name=GRB7)

[Back to BioLiP]