Structure of PDB 3po1 Chain C Binding Site BS01

Receptor Information
>3po1 Chain C (length=102) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GQPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGD
SGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVI
DQ
Ligand information
>3po1 Chain A (length=27) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ADCGLRPLFEKKSLEDKTERELLESYI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3po1 Discovery of benzothiazole guanidines as novel inhibitors of thrombin and trypsin IV.
Resolution1.65 Å
Binding residue
(original residue number in PDB)		N194 M241 K242 N247 R248 W249
Binding residue
(residue number reindexed from 1)		N10 M57 K58 N63 R64 W65
Enzymatic activity
Catalytic site (original residue number in PDB) E232 G233 D234 S235 G236
Catalytic site (residue number reindexed from 1) E48 G49 D50 S51 G52
Enzyme Commision number 3.4.21.5: thrombin.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3po1, PDBe:3po1, PDBj:3po1
PDBsum3po1
PubMed22726924
UniProtP00734|THRB_HUMAN Prothrombin (Gene Name=F2)

[Back to BioLiP]